Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d035089_circ_g.5 |
ID in PlantcircBase | zma_circ_008878 |
Alias | zma_circ_0002472 |
Organism | Zea mays |
Position | chr6: 4708890-4713211 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d035089 |
Parent gene annotation |
pleckstrin homology (PH) domain-containing protein |
Parent gene strand | - |
Alternative splicing | Zm00001d035089_circ_g.3 Zm00001d035089_circ_g.4 Zm00001d035089_circ_g.6 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d035089_T006:6 Zm00001d035089_T007:5 Zm00001d035089_T003:5 Zm00001d035089_T005:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.093462726 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4712770-4708919(+) 4713185-4713157(-) |
Potential amino acid sequence |
MALNSWTTTLVEASDLSFDLGKSTWILTTGAPRPSPVLHFSAHKIFVLFSGLITRRESSQARIV AASSHILHSIPSPENIVSTSFVPNLHGKFFPFTIL*(+) MFSGLGMECKIWDDAATILAWLDSLRVINPLNKTKILWAEKCSTGDGLGAPVVSIQVDFPKSNE RSEASTRVVVQEFNAIYEPEFFVNVLYIYNVFSAFQFQHDRVLSSLNRFNNLGTRLVSKLKYMS ANRKKLIWDLRIYHFVIRIPSQNCERKELAMEVWHEACRYNVFWAWYGM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |