Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d006790_circ_g.5 |
| ID in PlantcircBase | zma_circ_007387 |
| Alias | zma_circ_0000928 |
| Organism | Zea mays |
| Position | chr2: 216762463-216762808 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d006790 |
| Parent gene annotation |
Mitogen-activated protein kinase 16 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d006790_T003:1 Zm00001d006790_T011:1 Zm00001d006790_T009:2 Zm00001d006790_T012:2 Zm00001d006790_T006:2 Zm00001d006790_T004:2 Zm00001d006790_T007:2 Zm00001d006790_T005:2 Zm00001d006790_T002:1 Zm00001d006790_T008:2 Zm00001d006790_T013:2 Zm00001d006790_T010:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153652979 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
216762744-216762471(+) 216762552-216762806(-) |
| Potential amino acid sequence |
MHRSHSNIMLQLQINFHPMFLKCSR*(+) MLPLRWSSRRSLGIMFLKVCKLLFKIIYCT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |