Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d006790_circ_g.5 |
ID in PlantcircBase | zma_circ_007387 |
Alias | zma_circ_0000928 |
Organism | Zea mays |
Position | chr2: 216762463-216762808 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d006790 |
Parent gene annotation |
Mitogen-activated protein kinase 16 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d006790_T003:1 Zm00001d006790_T011:1 Zm00001d006790_T009:2 Zm00001d006790_T012:2 Zm00001d006790_T006:2 Zm00001d006790_T004:2 Zm00001d006790_T007:2 Zm00001d006790_T005:2 Zm00001d006790_T002:1 Zm00001d006790_T008:2 Zm00001d006790_T013:2 Zm00001d006790_T010:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.153652979 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
216762744-216762471(+) 216762552-216762806(-) |
Potential amino acid sequence |
MHRSHSNIMLQLQINFHPMFLKCSR*(+) MLPLRWSSRRSLGIMFLKVCKLLFKIIYCT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |