Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0221300_circ_g.1 |
ID in PlantcircBase | osa_circ_018570 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 6360912-6361189 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0221300 |
Parent gene annotation |
Similar to No apical meristem protein, expressed. (Os03t0221300- 01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0221300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.193644424 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6360970-6361180(-) 6361162-6361180(-) |
Potential amino acid sequence |
MVPDCTESDFQDLENVITKGFN*(-) MPQDYCRFFWTKEYWLKRLNSTVLKKKMIWSQTAQKVTFKILKMLLQKDSIETALEEDAPGLLQ ILLDKGILVKEIKLYGVEEEDDMVPDCTESDFQDLENVITKGFN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |