Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0285100_circ_g.2 |
ID in PlantcircBase | osa_circ_011127 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 10823451-10824325 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0285100 |
Parent gene annotation |
Hypothetical conserved gene. (Os12t0285100-01);Conserved hypothe tical protein. (Os12t0285100-02);Conserved hypothetical protein. (Os12t0285100-03);Hypothetical conserved gene. (Os12t0285100-04 ) |
Parent gene strand | + |
Alternative splicing | Os12g0285100_circ_g.3 Os12g0285100_circ_g.4 Os12g0285100_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0285100-03:2 Os12t0285100-01:1 Os12t0285100-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.105149067 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10824088-10823463(+) |
Potential amino acid sequence |
MSGAGQSRGHRLGLHIDSDWPEVLLINDYAVFMGYLSMVVTGTGFLVLTWSTVILLGGFVSMLS NKDFWSLTVITLVQTRRAAN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |