Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0285100_circ_g.2 |
| ID in PlantcircBase | osa_circ_011127 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 10823451-10824325 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0285100 |
| Parent gene annotation |
Hypothetical conserved gene. (Os12t0285100-01);Conserved hypothe tical protein. (Os12t0285100-02);Conserved hypothetical protein. (Os12t0285100-03);Hypothetical conserved gene. (Os12t0285100-04 ) |
| Parent gene strand | + |
| Alternative splicing | Os12g0285100_circ_g.3 Os12g0285100_circ_g.4 Os12g0285100_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0285100-03:2 Os12t0285100-01:1 Os12t0285100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.105149067 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10824088-10823463(+) |
| Potential amino acid sequence |
MSGAGQSRGHRLGLHIDSDWPEVLLINDYAVFMGYLSMVVTGTGFLVLTWSTVILLGGFVSMLS NKDFWSLTVITLVQTRRAAN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |