Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G094400_circ_g.1 |
| ID in PlantcircBase | gra_circ_001327 |
| Alias | Chr12:16951070|16952117 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 16951070-16952117 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G094400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.012G094400.5:3 Gorai.012G094400.1:3 Gorai.012G094400.6:3 Gorai.012G094400.2:3 Gorai.012G094400.3:3 Gorai.012G094400.4:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000317 |
| PMCS | 0.116659208 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16951857-16952108(-) 16951784-16952108(-) |
| Potential amino acid sequence |
MKVYAEQVSQLLATEKNLRLQLAADGEKFQQFQDALFKSNEVFETFKQEIEKVKK*(-) MEKNSNSFRMHCLRATRSLKHLSKRLRRLRNKLKEFADQCALAEQQYALKLKQKTLELQLANLK IKQHEEKLVEEQAQMKVYAEQVSQLLATEKNLRLQLAADGEKFQQFQDALFKSNEVFETFKQEI EKVKK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |