Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0714000_circ_g.5 |
| ID in PlantcircBase | osa_circ_032314 |
| Alias | Os_ciR10630 |
| Organism | Oryza sativa |
| Position | chr6: 30277138-30278490 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0714000 |
| Parent gene annotation |
Uncharacterised protein family UPF0183 domain containing protein . (Os06t0714000-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0714000_circ_g.2 Os06g0714000_circ_g.3 Os06g0714000_circ_g.4 Os06g0714000_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0714000-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23835752 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30277147-30278411(-) 30278490-30278460(-) |
| Potential amino acid sequence |
MQRDADFRCVRADRGPANTLRRCPREVLR*(-) MPISDAFAQIEGQPTLYDVVHVKYFDEEPLKLDFVISFPDHGFHLRFDPWSQRLRLIEIYDVKR LQLRYAKSLIGGPSTLATFVAVYGLFGPTFPGIYDKERGIYTLFYPGLSFAFPIPSQYTNLFTN GEVADLPLEFPDGTTPVTCRVSIYDSSTDSKVGVGSLMDKAVVPALPAGSLYMEEVHAKGCRFP MRSRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |