Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0524400_circ_g.2 |
| ID in PlantcircBase | osa_circ_031045 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 19416481-19416758 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0524400 |
| Parent gene annotation |
Protein of unknown function DUF231, plant domain containing prot ein. (Os06t0524400-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0524400_circ_g.3 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0524400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.258388189 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19416587-19416487(+) 19416580-19416579(+) 19416524-19416713(-) |
| Potential amino acid sequence |
MEGLTVAIFIGDGSPMAARCRGLRARSFWRPCGENIGLLLVIQSSEITFNRCFAFLLRKL*(+) MTNGRPDSGYLYWRWKPYGCEMSRFEGEKFLEAMRGKHWALIGDSILRNHVQSLLCLLAKEVVI YSMVNGSLIHLALITLTTAAASSRLRRTV*(+) MNQGPIYHGINHNFLSKKAKQRLNVISED*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |