Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G233400_circ_g.2 |
| ID in PlantcircBase | gra_circ_000874 |
| Alias | Chr08:51962168|51963096 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 51962168-51963096 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G233400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.008G233400_circ_g.1 |
| Support reads | 12/43 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.008G233400.2:2 Gorai.008G233400.3:2 Gorai.008G233400.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000747* |
| PMCS | 1.036010083 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
51962188-51962179(+) |
| Potential amino acid sequence |
MKNRLGLLLKFSVRLTSLSSVLEVLESSFKGRLSAQLHDLHHLQESILKTKQHLEITIWCIRHH FLEQVRSRHADFTSWRNHVRERKSASIVRAWPPPDVLDLSTNSTGQEASLFIEDALENLDIYEK IGEESDFAFLQKNGALSFLQSKIGGITGYYPFESLRAAVDILFLRGGSDLVVAKQAIIILR*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |