Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0406300_circ_g.2 |
| ID in PlantcircBase | osa_circ_033449 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12545154-12545982 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0406350 |
| Parent gene annotation |
Hypothetical protein. (Os07t0406350-00) |
| Parent gene strand | + |
| Alternative splicing | Os07g0406300_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0406300-02:2 Os07t0406300-01:1 Os07t0406300-02:2 Os07t0406300-01:1 Os07t0406350-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.333497959 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12545964-12545220(+) 12545915-12545162(+) 12545966-12545963(-) |
| Potential amino acid sequence |
MERRTLTLLHSEDSNYFYLVSYQDQEFCC*(+) MTFVLSYHHIFQLQGLHGTQNFNLAA*(+) MKPLQLEDVVIGQYKSHTKGGTTYPGYTEDKTVPKDSVTPTFAAAALFINNARWDGVPFLMKAG KALHTKGAEIRVQFRHVPGNLYKRSFGTDLDTATNELVIRVQPDEAIYLKINNKIPGLGMRLDR SNLNLHYAARLKFCVP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |