Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G10740_circ_g.1 |
ID in PlantcircBase | ath_circ_020932 |
Alias | Ath_circ_FC5670 |
Organism | Arabidpsis thaliana |
Position | chr3: 3361272-3361418 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G10740 |
Parent gene annotation |
Alpha-L-arabinofuranosidase 1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G10740.3:1 AT3G10740.4:1 AT3G10740.1:1 AT3G10740.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.220525166 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3361389-3361274(-) |
Potential amino acid sequence |
MQVLVTGLDPNVMRVSGSKKTVLTSTNVMDENSFSQPEKAVNFGANSENMQVLVTGLDPNVMRV SGSKKTVLTSTNVMDENSFSQPEKAVNFGANSENMQVLVTGLDPNVMRVSGSKKTVLTSTNVMD ENSFSQPEKAVNFGANSENMQVLVTGLDPNVMRVSGSKKTVLTSTNVMDENSFSQPEK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |