Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0795300_circ_g.5 |
| ID in PlantcircBase | osa_circ_016934 |
| Alias | Os02circ28932 |
| Organism | Oryza sativa |
| Position | chr2: 33810368-33811021 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl |
| Parent gene | Os02g0795300 |
| Parent gene annotation |
Similar to protein binding / zinc ion binding. (Os02t0795300-01) ;Similar to protein binding / zinc ion binding. (Os02t0795300-02 ) |
| Parent gene strand | - |
| Alternative splicing | Os02g0795300_circ_g.3 Os02g0795300_circ_g.4 |
| Support reads | 2/13 |
| Tissues | leaf and panicle/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0795300-02:2 Os02t0795300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004373* |
| PMCS | 0.483782245 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33810991-33810988(-) |
| Potential amino acid sequence |
MSSLCPFAKLASAGATCPVKSDNKTTSCPVTANNHTDDDDNEKTGNANTDPRVVPAKCPFGYDS NNTFKLGPLSCVVCHALLHQSSKCTPCSHKFCKACILRFKDCPLCGADIQGIEPDDELQGLVDR FIDGHARIKRSHAAGDGEAASDKTKVIYEHVSMERGAFLVQQAMRVNNNPPKTNRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |