Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0782600_circ_g.2 |
| ID in PlantcircBase | osa_circ_016826 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 33196960-33197840 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0782600 |
| Parent gene annotation |
Synaptojanin, N-terminal domain containing protein. (Os02t078260 0-01);Similar to SAC domain protein 1 (FIG4-like protein AtFIG4) . (Os02t0782600-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0782600_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0782600-02:2 Os02t0782600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124500501 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33196971-33197004(+) 33197028-33197814(-) |
| Potential amino acid sequence |
MIPQTHHVPGGVETESSIHSGDSNFLDLEWLSTSGNSSDERSIAISTPDVNLSAENVISGINSE TMVYTYDTSDTSCSRRR*(+) MNATFSFNAAWNMMCLRYHRCIPWSQNLCHL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |