Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0545300_circ_g.2 |
| ID in PlantcircBase | osa_circ_009547 |
| Alias | Os11circ06823/Os_ciR1218 |
| Organism | Oryza sativa |
| Position | chr11: 20067783-20068141 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os11g0545300 |
| Parent gene annotation |
Similar to Topoisomerase 6 subunit A-like protein. (Os11t0545300 -01);Hypothetical gene. (Os11t0545300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/20/5 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0545300-01:2 Os11t0545300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.33082637 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20068077-20067857(+) 20068017-20068074(-) 20067860-20068010(-) 20067838-20068105(-) |
| Potential amino acid sequence |
MRGKSGSGCLQFSLHVERTEHLNNGDGNDIDENKLSPCIHSSDRSSP*(+) MDDAERNTQPKSYIKMSQAPARKLPPLHWRGHGDDLSEEWMHGDNLFSSISLPSPLFKCSVLST WRENCRHPEPDFPLM*(-) MATIYLKNGCMATTYFHRYHCHHRYSNVLFFRRGGKIVDTPNRTSLSCRDSRFHLSFLISSRPR TAMHG*(-) MDAWRQLIFIDIIAITVIQMFCSFDVEGKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |