Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0118000_circ_g.1 |
| ID in PlantcircBase | osa_circ_000136 |
| Alias | Os_ciR5678 |
| Organism | Oryza sativa |
| Position | chr1: 1017440-1017916 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0118000 |
| Parent gene annotation |
Similar to Fructose-bisphosphate aldolase (EC 4.1.2.13) (Fragmen t). (Os01t0118000-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0118000_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0118000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.741201385 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1017860-1017477(+) 1017521-1017912(-) 1017517-1017872(-) |
| Potential amino acid sequence |
MVWLQGVLSTTSRGHASLSEICCFPRAWYPGN*(+) MDANLFPHVAFDSSIARIPRPGEATDFT*(-) MLISFRMWHSTHQLPGYHALGKQQISLSEACPLLVVLSTP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |