Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0182700_circ_g.1 |
ID in PlantcircBase | osa_circ_018246 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 4340794-4341626 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os03g0182700 |
Parent gene annotation |
Eukaryotic translation initiation factor 3 subunit 12 (eIF-3 p25 ) (eIF3k). (Os03t0182700-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 6 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0182700-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.151390236 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4341472-4341430(+) 4341474-4341579(-) 4340837-4341579(-) |
Potential amino acid sequence |
MRALINMRDTICTLNLSGSNWNNIQYVAVLRRLIPKLTEPSSLQVVRENYQRLELFLHLHMLWN *(+) MAMPGPDFSLCLFLIPEHVQMEEQFKTLIVLSHYLETARFRQFWDEASKNRNILDVVPVRTRKV ECADCISHID*(-) MRRRRTATYWMLFQFEPERLSVQIVSRILIKALMAMPGPDFSLCLFLIPEHVQMEEQFKTLIVL SHYLETARFRQFWDEASKNRNILDVVPVRTRKVECADCISHID*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |