Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0182700_circ_g.1 |
| ID in PlantcircBase | osa_circ_018246 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4340794-4341626 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0182700 |
| Parent gene annotation |
Eukaryotic translation initiation factor 3 subunit 12 (eIF-3 p25 ) (eIF3k). (Os03t0182700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0182700-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151390236 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4341472-4341430(+) 4341474-4341579(-) 4340837-4341579(-) |
| Potential amino acid sequence |
MRALINMRDTICTLNLSGSNWNNIQYVAVLRRLIPKLTEPSSLQVVRENYQRLELFLHLHMLWN *(+) MAMPGPDFSLCLFLIPEHVQMEEQFKTLIVLSHYLETARFRQFWDEASKNRNILDVVPVRTRKV ECADCISHID*(-) MRRRRTATYWMLFQFEPERLSVQIVSRILIKALMAMPGPDFSLCLFLIPEHVQMEEQFKTLIVL SHYLETARFRQFWDEASKNRNILDVVPVRTRKVECADCISHID*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |