Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0280500_circ_g.4 |
| ID in PlantcircBase | osa_circ_038702 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 5919150-5920779 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0280500 |
| Parent gene annotation |
Similar to Transcription factor HBP-1b(C38) (Fragment). (Os09t02 80500-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0280500_circ_g.3 Os09g0280500_circ_g.5 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0280500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.125944903 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5919176-5919221(+) |
| Potential amino acid sequence |
MADFDQASLFLYLDSHDQQSIQEQRQTLNIFPSQPMHVADPAHEAKSAGVAMAMLPNGNQLQVL PSHPSKKPDQQGGQKINSSVPTNPPGPNLPLPNSAKDNKNSSLIKKEGSSSGKGATTSNDPERE GRRTLDPKEQGIEQLRHGRFRSSFAFSLPRQS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |