Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g044630.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003108 |
Alias | 10:22680349|22680509 |
Organism | Solanum lycopersicum |
Position | chr10: 27205691-27205851 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI, circseq_cup |
Parent gene | Solyc10g044630.1 |
Parent gene annotation |
Probable magnesium transporter |
Parent gene strand | + |
Alternative splicing | Solyc10g044630.1_circ_g.2 |
Support reads | 2/6 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc10g044630.1.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.643431616 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27205776-27205842(-) |
Potential amino acid sequence |
MDPTTHKAQPKIPKVCSFSLKIIRASTALVQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zuo et al., 2016; Yin et al., 2018 |