Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc10g044630.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003108 |
| Alias | 10:22680349|22680509 |
| Organism | Solanum lycopersicum |
| Position | chr10: 27205691-27205851 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc10g044630.1 |
| Parent gene annotation |
Probable magnesium transporter |
| Parent gene strand | + |
| Alternative splicing | Solyc10g044630.1_circ_g.2 |
| Support reads | 2/6 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc10g044630.1.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.643431616 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27205776-27205842(-) |
| Potential amino acid sequence |
MDPTTHKAQPKIPKVCSFSLKIIRASTALVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018 |