Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0266800_circ_g.2 |
ID in PlantcircBase | osa_circ_019043 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8829327-8830519 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os03g0266800 |
Parent gene annotation |
Protein kinase, core domain containing protein. (Os03t0266800-01 );Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor k inase 1. (Os03t0266800-02) |
Parent gene strand | + |
Alternative splicing | Os03g0266800_circ_g.1 |
Support reads | 2 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0266800-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14782106 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8830193-8829346(+) 8830245-8829489(+) |
Potential amino acid sequence |
MNFLTGAIPSDGSLVNFNETSFIGNRGLCGKQINSVCKDALQSPSNGPLPPSAGFLHITS*(+) MKLPSSGTVVYVGSRLTRCAKMHFSHHQMALCHLPQDSCISQVSWAHTSRNWKVKSVASSITAR E*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |