Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0266800_circ_g.2 |
| ID in PlantcircBase | osa_circ_019043 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8829327-8830519 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os03g0266800 |
| Parent gene annotation |
Protein kinase, core domain containing protein. (Os03t0266800-01 );Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor k inase 1. (Os03t0266800-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0266800_circ_g.1 |
| Support reads | 2 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0266800-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.14782106 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8830193-8829346(+) 8830245-8829489(+) |
| Potential amino acid sequence |
MNFLTGAIPSDGSLVNFNETSFIGNRGLCGKQINSVCKDALQSPSNGPLPPSAGFLHITS*(+) MKLPSSGTVVYVGSRLTRCAKMHFSHHQMALCHLPQDSCISQVSWAHTSRNWKVKSVASSITAR E*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |