Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d026277_circ_g.1 |
ID in PlantcircBase | zma_circ_010355 |
Alias | zma_circ_0000082 |
Organism | Zea mays |
Position | chr10: 142713123-142720957 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d026277 |
Parent gene annotation |
coproporphyrinogen III oxidase2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d026277_T001:3 Zm00001d026277_T003:3 Zm00001d026277_T002:5 Zm00001d026277_T004:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.090683347 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
142713966-142713170(+) 142713184-142720888(-) 142713191-142720934(-) |
Potential amino acid sequence |
MIISILSTVTSGVGLVEYFLMTLMITIKKCFSTSLQVKPFARMIGWNYLYSECADSVLPAYIPI IERRKDTPFNEEHKEWQQLRRGRYVEFNLVYDRGTTFGLKTGGRIESILVSLPLTARWQYDHMH LVHQDSGGLAVVLT*(+) MRESSQYHRQTTTVLVHQVHMIILPPCCEWKGHEYALDSSSSL*(-) MMYEGVKSVPPPNHHCLGAPGAYDHTATVL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |