Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0243500_circ_g.3 |
| ID in PlantcircBase | osa_circ_036478 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 8763384-8763535 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0243500 |
| Parent gene annotation |
Similar to NADPH-cytochrome P450 oxydoreductase isoform 2. (Os08 t0243500-01);Similar to NADPH--cytochrome P450 reductase. (Os08t 0243500-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0243500_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0243500-02:1 Os08t0243500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.383495504 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8763436-8763426(+) 8763527-8763530(-) |
| Potential amino acid sequence |
MAEFPSAKPPLGVFFAAVAPRLQPRYYSISSSPRMSMLNGLLRVKEVY*(+) MKLSSISAEDEEQRLQRRLLVEALLKGTLPSLLIDFFDSQQPIEHTHPR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |