Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0243500_circ_g.3 |
ID in PlantcircBase | osa_circ_036478 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 8763384-8763535 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0243500 |
Parent gene annotation |
Similar to NADPH-cytochrome P450 oxydoreductase isoform 2. (Os08 t0243500-01);Similar to NADPH--cytochrome P450 reductase. (Os08t 0243500-02) |
Parent gene strand | + |
Alternative splicing | Os08g0243500_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0243500-02:1 Os08t0243500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.383495504 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8763436-8763426(+) 8763527-8763530(-) |
Potential amino acid sequence |
MAEFPSAKPPLGVFFAAVAPRLQPRYYSISSSPRMSMLNGLLRVKEVY*(+) MKLSSISAEDEEQRLQRRLLVEALLKGTLPSLLIDFFDSQQPIEHTHPR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |