Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g015210.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_001707 |
| Alias | 5:10063412|10066958 |
| Organism | Solanum lycopersicum |
| Position | chr5: 10063412-10066958 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc05g015210.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Solyc05g015210.2_circ_g.2 Solyc05g015210.2_circ_g.4 |
| Support reads | 4 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc05g015210.2.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172846126 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10065551-10063417(+) 10063453-10065692(-) |
| Potential amino acid sequence |
MQLLEMYLEPMNGKEPMFKAAVRLLHNHGEMLDPLQVLERLSPDMPLQLASETILRMLRARLHH HRQGQMK*(+) MSTFLGSIAAITSFGLDDDGEVELSTSLILSQKQVEGAYLVTISPKLAKGLAFLHDCATGAQQL *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Tan et al., 2017; Yin et al., 2018 |