Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022010_circ_g.4 |
ID in PlantcircBase | zma_circ_009462 |
Alias | Zm07circ00088, GRMZM2G090715_C1 |
Organism | Zea mays |
Position | chr7: 167922185-167922660 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d022010 |
Parent gene annotation |
Eukaryotic aspartyl protease family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d022010_circ_g.1 Zm00001d022010_circ_g.2 Zm00001d022010_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d022010_T006:3 Zm00001d022010_T004:3 Zm00001d022010_T007:3 Zm00001d022010_T001:3 Zm00001d022010_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201842192 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
167922644-167922398(+) 167922434-167922652(-) |
Potential amino acid sequence |
MHFTCHLLIVLLDLYHFGIHPNNKPHQPWSAGINNFQV*(+) MVFGNGQKLSLTPENYLFRHSKVDGAYCLGVFQNGKDPTTLLGGDK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |