Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G174600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000639 |
| Alias | Chr06:43306712|43307830 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 43306712-43307830 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G174600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G174600.7:3 Gorai.006G174600.2:4 Gorai.006G174600.5:3 Gorai.006G174600.4:4 Gorai.006G174600.3:4 Gorai.006G174600.1:4 Gorai.006G174600.6:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113145353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43307802-43306742(+) 43307047-43306792(+) 43306914-43307357(-) |
| Potential amino acid sequence |
MPMNSLVGCRRSKWNWVGNF*(+) MFCPFQLSQDGIEVQFATNHIGHFLLTNLLLDTMKNTVKASGIQGRVVNLSSIAHNYCYKKGIR FHKINDKQGYSEKRAYGQSKLANILHANELSRRLQEEQVELGWKLLEYWLFVESTSSSVQGT*( +) MKLSANDLIELVEQRSSSRTSIRALGVSLTILFFASFAAFMFLAPMMTWTPRRANTLEVSNPIP LAPPATDERVHWHAIYLLIWTAHMLFSHCILVCH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |