Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0230500_circ_g.1 |
| ID in PlantcircBase | osa_circ_033250 |
| Alias | Os_ciR11309 |
| Organism | Oryza sativa |
| Position | chr7: 7259654-7259787 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0230500 |
| Parent gene annotation |
Similar to endo/excinuclease amino terminal domain-containing pr otein. (Os07t0230500-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0230500-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.310475746 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7259681-7259656(-) |
| Potential amino acid sequence |
MLNLPSWENSSGRGSTRRNRWPCARPPRASSRSAASAARSSSPTPCSTSPPGRIRVGVAAPDGI AGRAQGRRELQVARRRRQQGQARLHHAQPPLLGEFEWAWQHPTESLAVRKAAASFKSLGGVGSK VKLAYTMLNLPSWE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |