Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0198400_circ_g.5 |
| ID in PlantcircBase | osa_circ_013677 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5513387-5513834 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0198400 |
| Parent gene annotation |
Similar to predicted protein. (Os02t0198400-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0198400_circ_g.2 Os02g0198400_circ_g.3 Os02g0198400_circ_g.4 Os02g0198400_circ_g.6 Os02g0198400_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0198400-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.31778218 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5513699-5513426(+) 5513806-5513658(+) 5513806-5513803(-) |
| Potential amino acid sequence |
MLIHIVFILRYAAEIAIGSVRRLSLLLDMNSSVSIICLLHLFAAAVSLAKSQDLSQNLQ*(+) MPPAPFCRSSLTCQESRSLSKSAVAMSSSATCSSGLDGGLAERKPFNRLQSSVLYRDAAIFGRS IELGSIF*(+) MIETDEFMSSNNDSLLTDPMAISAAYLKMKTICINISREIQADIKIHNQNILPSSIDLPNIAAS LYSTELCKRLKGFLSASPPSRPLEHVAELLIATADFERDLDSWQVRLLRQKGAGGI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |