Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G25300_circ_g.1 |
ID in PlantcircBase | ath_circ_014749 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 10773287-10773616 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT2G25300 |
Parent gene annotation |
Hydroxyproline O-galactosyltransferase HPGT3 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 6 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G25300.2:2 AT2G25300.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.186963965 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10773586-10773289(-) |
Potential amino acid sequence |
MELTLAKSQGYLKNLKSGSSSGKKLLAVIGVYSGFGSHLRRNTFRGSYMPQGDALRKLEERGIV IRFVIGRRDLERRIVETEMELTLAKSQGYLKNLKSGSSSGKKLLAVIGVYSGFGSHLRRNTFRG SYMPQGDALRKLEERGIVIRFVIGRRDLERRIVETEMELTLAKSQGYLKNLKSGSSSGKKLLAV IGVYSGFGSHLRRNTFRGSYMPQGDALRKLEERGIVIRFVIGRRDLERRIVETEMELTLAKSQG YLKNLKSGSSSGKKLLAVIGVYSGFGSHLRRNTFRGSYMPQGDALRKLEERGIVIRFVIGR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |