Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G152800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000497 |
| Alias | Chr05:42583357|42584239 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 42583357-42584239 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G152800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 14/38 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G152800.2:2 Gorai.005G152800.3:2 Gorai.005G152800.6:2 Gorai.005G152800.7:2 Gorai.005G152800.4:2 Gorai.005G152800.5:2 Gorai.005G152800.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000689* |
| PMCS | 1.122230983 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42584192-42584220(-) 42584053-42584237(-) |
| Potential amino acid sequence |
MEDEKQGDVRIDLFAALDMENEAVAERSPELENSQTLGLLTGFLLVDDWYHAHILFDRLSPLNP VAHVRICKGLFRLTKLEK*(-) MIGTMPISSLIAFHLLIQWHMFESARGYLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |