Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d053545_circ_g.4 |
| ID in PlantcircBase | zma_circ_000261 |
| Alias | NA |
| Organism | Zea mays |
| Position | chr4: 233604385-233604510 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Zm00001d053545 |
| Parent gene annotation |
NAD(P)-binding Rossmann-fold superfamily protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d053545_circ_g.3 |
| Support reads | 3 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d053545_T004:1 Zm00001d053545_T003:1 Zm00001d053545_T001:1 Zm00001d053545_T002:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.821398046 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
233604433-233604507(+) |
| Potential amino acid sequence |
MGGVSESTFQILPTGSESSGPTGLFKGNLSGEIVWGALDDVVMGGVSESTFQILPTGSESSGPT GLFKGNLSGEIVWGALDDVVMGGVSESTFQILPTGSESSGPTGLFKGNLSGEIVWGALDDVVMG GVSESTFQILPTGSESSGPTGLFK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |