Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d053545_circ_g.4 |
ID in PlantcircBase | zma_circ_000261 |
Alias | NA |
Organism | Zea mays |
Position | chr4: 233604385-233604510 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Zm00001d053545 |
Parent gene annotation |
NAD(P)-binding Rossmann-fold superfamily protein |
Parent gene strand | + |
Alternative splicing | Zm00001d053545_circ_g.3 |
Support reads | 3 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d053545_T004:1 Zm00001d053545_T003:1 Zm00001d053545_T001:1 Zm00001d053545_T002:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.821398046 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
233604433-233604507(+) |
Potential amino acid sequence |
MGGVSESTFQILPTGSESSGPTGLFKGNLSGEIVWGALDDVVMGGVSESTFQILPTGSESSGPT GLFKGNLSGEIVWGALDDVVMGGVSESTFQILPTGSESSGPTGLFKGNLSGEIVWGALDDVVMG GVSESTFQILPTGSESSGPTGLFK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |