Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0187000_circ_g.2 |
| ID in PlantcircBase | osa_circ_026894 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 5334394-5334540 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0187000 |
| Parent gene annotation |
Beta 2 subunit of 20S proteasome (20S proteasome beta subunit). (Os05t0187000-01);Similar to Proteasome subunit beta type 7-A. ( Os05t0187000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0187000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.208254989 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5334401-5334537(+) |
| Potential amino acid sequence |
MAGATDLPPKGGFSYDNCARNAMLVEKGLKMPGFLKTGTTIVGLVFQRGMAGATDLPPKGGFSY DNCARNAMLVEKGLKMPGFLKTGTTIVGLVFQRGMAGATDLPPKGGFSYDNCARNAMLVEKGLK MPGFLKTGTTIVGLVFQRGMAGATDLPPKGGFSYDNCARNAMLVEKGLKMPGFLKTGTTIVGLV FQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |