Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d045744_circ_g.4 |
ID in PlantcircBase | zma_circ_009918 |
Alias | Zm09circ00026, zma_circ_0002931, GRMZM2G455687_C2 |
Organism | Zea mays |
Position | chr9: 36407275-36407614 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d045744 |
Parent gene annotation |
SMAD/FHA domain-containing protein |
Parent gene strand | + |
Alternative splicing | Zm00001d045744_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d045744_T003:2 Zm00001d045744_T005:1 Zm00001d045744_T001:1 Zm00001d045744_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.316839612 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
36407285-36407284(+) 36407522-36407297(+) |
Potential amino acid sequence |
MKKEIDAIRVKDISQGGLTQGQQTQIARNEQRMSQIMEELDNLEETLNDSIRESIGARSGKAKR GSYKASLEEEDDVLRLPT*(+) MTVYGKVLVLVLERQSVAAIKQVSRKKMTFLDCQHEKRN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |