Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d045744_circ_g.4 |
| ID in PlantcircBase | zma_circ_009918 |
| Alias | Zm09circ00026, zma_circ_0002931, GRMZM2G455687_C2 |
| Organism | Zea mays |
| Position | chr9: 36407275-36407614 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d045744 |
| Parent gene annotation |
SMAD/FHA domain-containing protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d045744_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d045744_T003:2 Zm00001d045744_T005:1 Zm00001d045744_T001:1 Zm00001d045744_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.316839612 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36407285-36407284(+) 36407522-36407297(+) |
| Potential amino acid sequence |
MKKEIDAIRVKDISQGGLTQGQQTQIARNEQRMSQIMEELDNLEETLNDSIRESIGARSGKAKR GSYKASLEEEDDVLRLPT*(+) MTVYGKVLVLVLERQSVAAIKQVSRKKMTFLDCQHEKRN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |