Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G46030_circ_g.1 |
| ID in PlantcircBase | ath_circ_018636 |
| Alias | Ath_circ_FC5150 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18932457-18932585 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT2G46030 |
| Parent gene annotation |
ubiquitin-conjugating enzyme 6 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 79 |
| Tissues | root, inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G46030.1:1 AT2G46030.3:1 AT2G46030.5:1 AT2G46030.4:1 AT2G46030.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214069444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18932494-18932459(-) |
| Potential amino acid sequence |
MRDRAAYELKVKDLINVFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKDLINVFESF LPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKDLINVFESFLPQLLLYPNPSDPFNGEAASL LMRDRAAYELKVK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |