Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G26850_circ_g.5 |
ID in PlantcircBase | ath_circ_033011 |
Alias | Ath_circ_FC2825 |
Organism | Arabidpsis thaliana |
Position | chr4: 13500329-13500571 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G26850 |
Parent gene annotation |
GDP-L-galactose phosphorylase 1 |
Parent gene strand | - |
Alternative splicing | AT4G26850_circ_g.3 AT4G26850_circ_g.4 |
Support reads | 89 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G26850.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.564411422 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13500374-13500331(-) |
Potential amino acid sequence |
MPIDPENSPSVVAINVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEEL LFQFEAGEDAQVQFFPCMPIDPENSPSVVAINVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQ SFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMPIDPENSPSVVAINVIPGKYGFVAQLNEG RHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMPIDPENSPSVVA IN(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |