Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0533100_circ_g.1 |
| ID in PlantcircBase | osa_circ_002011 |
| Alias | Os_ciR5803 |
| Organism | Oryza sativa |
| Position | chr1: 19278040-19281569 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0533100 |
| Parent gene annotation |
Similar to ATGSL07 (glucan synthase-like 7); 1,3-beta-glucan syn thase/ transferase, transferring glycosyl groups. (Os01t0533100- 00) |
| Parent gene strand | - |
| Alternative splicing | Os01g0533100_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0533100-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.096121797 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19281539-19278520(-) |
| Potential amino acid sequence |
MDPNSGGRGVRQFKTYLLHRLEKDEHETQRRLAGTDAKEIQRFYEHYCKKNLVDGLKTKKPEEM ARHYQIASVLYDVLKTVTPEKFHAEFDIYAKEVEKEKASFSHYNILPLNISGQRQPVMEIPEIK AAVDLLRKIDGLPMPRLDPVSAEKETDVPTVRDLFDWLWLTFGFQVGLPRSRRLTPWIQTQVDE EFGNSKHTSCIGWRRMNTRHSADLQEQMRKRFSGFMSIIVKKILWTVLRQKNRRRWLDTIRLRP SYMMC*(-) |
| Sponge-miRNAs | osa-miR2919 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |