Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0467800_circ_g.1 |
| ID in PlantcircBase | osa_circ_033712 |
| Alias | Os_ciR10914 |
| Organism | Oryza sativa |
| Position | chr7: 16652622-16655458 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0467800 |
| Parent gene annotation |
Similar to Transposon protein. (Os07t0467800-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0467800_circ_g.2 Os07g0467800_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0467800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202345641 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16655403-16652648(+) 16652718-16655445(-) |
| Potential amino acid sequence |
MKADVPAHLAILLFYLLLLGSCFFCSLQ*(+) MSPVFRYSTRIGENNHQVAPYNHCKLQKKQDPKSNK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |