Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0213900_circ_g.3 |
ID in PlantcircBase | osa_circ_018519 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 5970553-5973084 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0213900 |
Parent gene annotation |
Conserved hypothetical protein. (Os03t0213900-01);Similar to ROU GH SHEATH2-interacting KH-domain protein. (Os03t0213900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0213900-01:2 Os03t0213900-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014052 |
PMCS | 0.123984123 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5972608-5970650(+) |
Potential amino acid sequence |
MTNSSIEPPIKVQPGSNGMLLQDQPHVSAHPSASKNMLPPPPPPPRNMLPPPPKSMPPPPPKFP SNEMSRNEDRCADLNKPMAPPKSMPPPPPKSMPPPPPKFPSNEMSRNEDRRSDLNKPMAPPRSL DVSSVSPPNLYSAQLPSKEPRVVKPGGASVSEFLLQKYMVLFHLRSNYWMVYKRQEQYQMYTLL *(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |