Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0213900_circ_g.3 |
| ID in PlantcircBase | osa_circ_018519 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 5970553-5973084 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0213900 |
| Parent gene annotation |
Conserved hypothetical protein. (Os03t0213900-01);Similar to ROU GH SHEATH2-interacting KH-domain protein. (Os03t0213900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0213900-01:2 Os03t0213900-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014052 |
| PMCS | 0.123984123 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5972608-5970650(+) |
| Potential amino acid sequence |
MTNSSIEPPIKVQPGSNGMLLQDQPHVSAHPSASKNMLPPPPPPPRNMLPPPPKSMPPPPPKFP SNEMSRNEDRCADLNKPMAPPKSMPPPPPKSMPPPPPKFPSNEMSRNEDRRSDLNKPMAPPRSL DVSSVSPPNLYSAQLPSKEPRVVKPGGASVSEFLLQKYMVLFHLRSNYWMVYKRQEQYQMYTLL *(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |