Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d050024_circ_g.1 |
ID in PlantcircBase | zma_circ_008031 |
Alias | Zm04circ00030, ZmciR200 |
Organism | Zea mays |
Position | chr4: 60866699-60868024 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d050024 |
Parent gene annotation |
Formin-like protein 18 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d050024_T001:6 Zm00001d050024_T003:6 Zm00001d050024_T004:5 Zm00001d050024_T002:6 Zm00001d050024_T005:6 Zm00001d050024_T007:6 Zm00001d050024_T009:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.039447392 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
60867991-60866768(+) 60867993-60868022(-) |
Potential amino acid sequence |
MIPQLLARRRSISSSALVQCISERKNCLHNPFQLD*(+) MLTKVKMPLPDLMSAILALDDTVLDADQVENLIKFTPTKDEIELLKGYKGDKQVLGECEQFFME LMKLPRVESKLRVFSFKIQFRSQVSDLKRNLNIVNSSAEEIRGSVKLKRIMQTILSLGNALNQG TARD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |