Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc07g044860.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002345 |
| Alias | Slcirc110 |
| Organism | Solanum lycopersicum |
| Position | chr7: 57922546-57922778 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc07g044860.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/20 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc07g044860.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.925044968 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
57922735-57922573(+) 57922777-57922765(-) |
| Potential amino acid sequence |
MARNQCFPLAYQKHLFREELFRGAVVGDGLLVSWSNCNNKITCGIKVVFISENLTRVLNFFAGV PFGWDLELESISIVWQEISVFLWLTKNICLERNSSGEP*(+) MFLVSQRKTLISCHTMEMDSSSKSQPNGTPAKKLSTLVRFSDMKTTLIPQVILLLQLLQLTRSP SPTTAPLKSSSLNKCFW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Wang et al., 2018b |