Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d023792_circ_g.2 |
| ID in PlantcircBase | zma_circ_010178 |
| Alias | Zm10circ00016 |
| Organism | Zea mays |
| Position | chr10: 20863529-20882186 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d023792 |
| Parent gene annotation |
Phosphoglucan water dikinase chloroplastic |
| Parent gene strand | + |
| Alternative splicing | Zm00001d023792_circ_igg.1 Zm00001d023792_circ_igg.2 Zm00001d023792_circ_g.1 Zm00001d023792_circ_g.3 Zm00001d023792_circ_g.4 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d023792_T006:6 Zm00001d023792_T003:6 Zm00001d023792_T008:7 Zm00001d023792_T007:7 Zm00001d023792_T009:3 Zm00001d023792_T004:6 Zm00001d023792_T002:6 Zm00001d023792_T001:6 Zm00001d023792_T005:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109871387 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20864163-20863552(+) |
| Potential amino acid sequence |
MKGLESGLRNDAPDSAIAMRQKWRLCEIGLEDYSFVLLSRYINALEALGGSASLAEGLPTNTSL WDDALDALIIGINQVCFSGWKPNECSAIVNELLSWKQKGLSEFEGNEDGKYIWALRLKATLDRT GRLTEEYSEALLSIFPEKVKVLGKALGIPENSVRTYTEAEIRASVIFQVSKLCTVLLKATRAVL GSSVWDVLVPGVAHGALIQSTGATGIY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |