Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0654500_circ_g.9 |
ID in PlantcircBase | osa_circ_002968 |
Alias | Os_ciR1043 |
Organism | Oryza sativa |
Position | chr1: 26534610-26534915 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0654500 |
Parent gene annotation |
Similar to NADP-isocitrate dehydrogenase. (Os01t0654500-01) |
Parent gene strand | - |
Alternative splicing | Os01g0654500_circ_g.3 Os01g0654500_circ_g.4 Os01g0654500_circ_g.5 Os01g0654500_circ_g.6 Os01g0654500_circ_g.7 Os01g0654500_circ_g.8 Os01g0654500_circ_g.10 Os01g0654500_circ_g.11 Os01g0654500_circ_g.12 Os01g0654500_circ_g.13 Os01g0654500_circ_g.14 Os01g0654500_circ_g.15 Os01g0654500_circ_g.16 Os01g0654500_circ_g.17 Os01g0654500_circ_g.18 Os01g0654500_circ_g.19 |
Support reads | 15/3 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0654500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.423566476 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26534890-26534887(-) 26534823-26534898(-) 26534614-26534887(-) |
Potential amino acid sequence |
MTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKFEAAGICQSELLLKLL*(-) MMEGSRIFSRRSMKLGGNPSLRLPEYVNPSFC*(-) MSIRAFAEASMTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKFEAAGICQSELL LKLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |