Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0654500_circ_g.9 |
| ID in PlantcircBase | osa_circ_002968 |
| Alias | Os_ciR1043 |
| Organism | Oryza sativa |
| Position | chr1: 26534610-26534915 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0654500 |
| Parent gene annotation |
Similar to NADP-isocitrate dehydrogenase. (Os01t0654500-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0654500_circ_g.3 Os01g0654500_circ_g.4 Os01g0654500_circ_g.5 Os01g0654500_circ_g.6 Os01g0654500_circ_g.7 Os01g0654500_circ_g.8 Os01g0654500_circ_g.10 Os01g0654500_circ_g.11 Os01g0654500_circ_g.12 Os01g0654500_circ_g.13 Os01g0654500_circ_g.14 Os01g0654500_circ_g.15 Os01g0654500_circ_g.16 Os01g0654500_circ_g.17 Os01g0654500_circ_g.18 Os01g0654500_circ_g.19 |
| Support reads | 15/3 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0654500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.423566476 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26534890-26534887(-) 26534823-26534898(-) 26534614-26534887(-) |
| Potential amino acid sequence |
MTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKFEAAGICQSELLLKLL*(-) MMEGSRIFSRRSMKLGGNPSLRLPEYVNPSFC*(-) MSIRAFAEASMTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKFEAAGICQSELL LKLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |