Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0857000_circ_g.1 |
ID in PlantcircBase | osa_circ_004873 |
Alias | Os_ciR4518 |
Organism | Oryza sativa |
Position | chr1: 37024504-37026364 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os01g0857000 |
Parent gene annotation |
Double-stranded RNA-binding-like domain containing protein. (Os0 1t0857000-01);Similar to CPL2 (CTD phosphatase-like 2); double-s tranded RNA binding. (Os01t0857000-02) |
Parent gene strand | - |
Alternative splicing | Os01g0857000_circ_g.2 Os01g0857000_circ_g.3 Os01g0857000_circ_g.4 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0857000-02:3 Os01t0857000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.106113098 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37026308-37025925(+) 37026348-37025869(+) |
Potential amino acid sequence |
MLSQNPVLDREILHVGPPSTYWSQMLLDLWVRSCFQGLQRLFCSLKLRKIFVQINAPPKNLSS* (+) MLVLQALTGLKCFLICGSVVVFKVFSASSAA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |