Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g069780.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_000656 |
| Alias | 2:34187693|34190796 |
| Organism | Solanum lycopersicum |
| Position | chr2: 39609843-39612946 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g069780.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Solyc02g069780.2_circ_g.1 Solyc02g069780.2_circ_g.2 Solyc02g069780.2_circ_g.4 |
| Support reads | 5 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc02g069780.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.136299681 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39610436-39609874(+) 39609930-39610404(-) |
| Potential amino acid sequence |
MAYSRVCRRIVNGLIGRQIFFKNGMLWKMFSSGLVDYRVCFSLGEC*(+) MRLTAPSRINSFSAASLLTLTKTETNSIIHKPTGKHFPQHSVFEEYLSANQSIHYSPADATVCH YYCSLVEQVC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |