Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0686400_circ_g.2 |
ID in PlantcircBase | osa_circ_015988 |
Alias | Os_ciR7985 |
Organism | Oryza sativa |
Position | chr2: 28115954-28117173 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0686400 |
Parent gene annotation |
Similar to Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tR NA ligase) (AspRS). (Os02t0686400-01);Similar to Aspartyl-tRNA s ynthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS). (Os02t 0686400-02) |
Parent gene strand | + |
Alternative splicing | Os02g0686400_circ_g.3 Os02g0686400_circ_g.4 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0686400-02:3 Os02t0686400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.229019426 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28116211-28115963(+) |
Potential amino acid sequence |
MLKEAGTEIEPMGDLNTEAEKKLGRLVKEKFAT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |