Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0686400_circ_g.2 |
| ID in PlantcircBase | osa_circ_015988 |
| Alias | Os_ciR7985 |
| Organism | Oryza sativa |
| Position | chr2: 28115954-28117173 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0686400 |
| Parent gene annotation |
Similar to Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tR NA ligase) (AspRS). (Os02t0686400-01);Similar to Aspartyl-tRNA s ynthetase (EC 6.1.1.12) (Aspartate--tRNA ligase) (AspRS). (Os02t 0686400-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0686400_circ_g.3 Os02g0686400_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0686400-02:3 Os02t0686400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.229019426 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28116211-28115963(+) |
| Potential amino acid sequence |
MLKEAGTEIEPMGDLNTEAEKKLGRLVKEKFAT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |