Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0726400_circ_g.4 |
| ID in PlantcircBase | osa_circ_032431 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 30900682-30900798 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0726400 |
| Parent gene annotation |
Branching enzyme-I precursor (Starch-branching enzyme I) (1,4-al pha- glucan branching enzyme I). (Os06t0726400-01);Similar to 1, 4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic. (Os 06t0726400-02);Hypothetical conserved gene. (Os06t0726400-03);Si milar to 1,4-alpha-glucan-branching enzyme, chloroplastic/amylop lastic. (Os06t0726400-04) |
| Parent gene strand | - |
| Alternative splicing | Os06g0726400_circ_g.1 Os06g0726400_circ_g.2 Os06g0726400_circ_g.3 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0726400-01:1 Os06t0726400-04:1 Os06t0726400-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.308410256 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30900696-30900795(+) 30900764-30900684(-) |
| Potential amino acid sequence |
MPRLMVGEAGCKSDMPVYISLSIKRNAIVLSPTMDFWSAMPRLMVGEAGCKSDMPVYISLSIKR NAIVLSPTMDFWSAMPRLMVGEAGCKSDMPVYISLSIKRNAIVLSPTMDFWSAMPRLMVGEAGC KSDMPVYISLSIKRNAIVLSPTM(+) MDKEMYTGMSDLQPASPTINRGIALQKSIVGDKTIAFLLMDKEMYTGMSDLQPASPTINRGIAL QKSIVGDKTIAFLLMDKEMYTGMSDLQPASPTINRGIALQKSIVGDKTIAFLLMDKEMYTGMSD LQPASPTINRGIALQK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |