Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G082800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000047 |
| Alias | Chr01:8805507|8805885 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 8805507-8805885 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G082800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 9/37 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G082800.2:2 Gorai.001G082800.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000321* gar_circ_000054 |
| PMCS | 1.106640325 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8805533-8805848(-) 8805520-8805882(-) |
| Potential amino acid sequence |
MLHLHATICYNFGDKCPPRFC*(-) MQQFAIILGINVHPVFADDGSNQTNTESDIQGANISGLRKIEDGSVISNVHTSKWRIFTDNGRD YFLQGKLEEAEKFFLSAIQEAKEGFGERDPHVASACNNLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |