Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g084990.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_000754 |
| Alias | 2:42599448|42599642 |
| Organism | Solanum lycopersicum |
| Position | chr2: 48021598-48021792 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc02g084990.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6/11 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc02g084990.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.799157439 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
48021602-48021600(-) 48021676-48021779(-) |
| Potential amino acid sequence |
MGLDFVISEARRYGIKVILSFANNYESFGGKKQYVNWARSHGQYLNSDDDFFKNSVVKGYYKNH IMGLDFVISEARRYGIKVILSFANNYESFGGKKQYVNWARSHGQYLNSDDDFFKNSVVKGYYKN HIMGLDFVISEARRYGIKVILSFANNYESFGGKKQYVNWARSHGQYLNSDDDFFKNSVVKGYYK NHIM(-) MDSTSIQMMISSKTQLLRAITRIILWVWIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018 |