Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G186900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000297 |
| Alias | Chr03:45720792|45721645 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 45720792-45721645 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G186900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G186900.4:3 Gorai.003G186900.2:3 Gorai.003G186900.3:3 Gorai.003G186900.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.489110519 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45720842-45721629(-) 45721460-45721458(-) |
| Potential amino acid sequence |
MNTLTRMKNKCLRQNKSCIISF*(-) MKSQNGKPRTQVQHLMQIDLKGWGVGYISSFQQHCLLQMLNSVAGLREWFAQTDERGATPRIPV MVNMASSSVSSKKTQRMFELSVPSAPSLDQTNAANRNSVLMDEYSDEDEEQMPEAEQELYYFVL GSMRIAAHNQDMCGLMLRVEGSTFPL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |