Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0163400_circ_g.1 |
| ID in PlantcircBase | osa_circ_026772 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 3719017-3719648 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os05g0163400 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os05 t0163400-01);Non-protein coding transcript. (Os05t0163400-02);Zi nc finger, RING/FYVE/PHD-type domain containing protein. (Os05t0 163400-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 20 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0163400-01:2 Os05t0163400-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.284113212 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3719528-3719020(+) 3719631-3719087(+) 3719626-3719076(+) 3719270-3719630(-) |
| Potential amino acid sequence |
MSKWCTVTRNRKRWHRCTYVGALWSRIVWPLSECYATTIRPS*(+) MLLPSGPHSSCHQCPVSCPSEDRMLLLIHG*(+) MLCYYHQALIAHVINVQSHVPVRIECFS*(+) MRDSYHGFHHLMIEDNNLGRSAAERFMMLDQLVIHESREAFDPHWDMRLDIDDMSYEGLMVVA* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |