Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G13000_circ_g.20 |
| ID in PlantcircBase | ath_circ_037873 |
| Alias | At_ciR5933 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4119174-4119523 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT5G13000 |
| Parent gene annotation |
Callose synthase 3 |
| Parent gene strand | - |
| Alternative splicing | AT5G13000_circ_g.17 AT5G13000_circ_g.18 AT5G13000_circ_g.19 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G13000.1:2 AT5G13000.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242653695 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4119497-4119176(-) |
| Potential amino acid sequence |
MKKLFKNYKKWCKYLGRKSSLWLPTIQQEMQQRKLLYMALYLLIWGEAANLRFMPECLCYIYHH LDDQALTEVMKKLFKNYKKWCKYLGRKSSLWLPTIQQEMQQRKLLYMALYLLIWGEAANLRFMP ECLCYIYHHLDDQALTEVMKKLFKNYKKWCKYLGRKSSLWLPTIQQEMQQRKLLYMALYLLIWG EAANLRFMPECLCYIYHHLDDQALTEVMKKLFKNYKKWCKYLGRKSSLWLPTIQQEMQQRKLLY MALYLLIWGEAANLRFMPECLCYIYHH(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |