Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0707900_circ_g.1 |
| ID in PlantcircBase | osa_circ_016173 |
| Alias | Os_ciR8019 |
| Organism | Oryza sativa |
| Position | chr2: 29262974-29263382 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0707900 |
| Parent gene annotation |
Rossmann-like alpha/beta/alpha sandwich fold domain containing p rotein. (Os02t0707900-01);Rossmann-like alpha/beta/alpha sandwic h fold domain containing protein. (Os02t0707900-02);Hypothetical conserved gene. (Os02t0707900-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0707900-02:2 Os02t0707900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172983007 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29263078-29262976(+) 29263271-29263046(+) 29263373-29263378(-) |
| Potential amino acid sequence |
MLHILSPVDGIDSQSARASEALLSCLSVSFSESLVEMHRCYPYHQIL*(+) MALIHKVLEQVKPSYLVSLFHSLKVWWRCIDAIHIIKSSEMVQGPYFPQLEDLVELSSPRCR*( +) MDSIYASPPDFQRMKQRDKIRGLHLLEHFVNQCHQLEIKCEAWIKQGDPKEVICSEVKRVQPDL LVVGSRGLGPFQRI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |