Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0707900_circ_g.1 |
ID in PlantcircBase | osa_circ_016173 |
Alias | Os_ciR8019 |
Organism | Oryza sativa |
Position | chr2: 29262974-29263382 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0707900 |
Parent gene annotation |
Rossmann-like alpha/beta/alpha sandwich fold domain containing p rotein. (Os02t0707900-01);Rossmann-like alpha/beta/alpha sandwic h fold domain containing protein. (Os02t0707900-02);Hypothetical conserved gene. (Os02t0707900-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0707900-02:2 Os02t0707900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.172983007 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29263078-29262976(+) 29263271-29263046(+) 29263373-29263378(-) |
Potential amino acid sequence |
MLHILSPVDGIDSQSARASEALLSCLSVSFSESLVEMHRCYPYHQIL*(+) MALIHKVLEQVKPSYLVSLFHSLKVWWRCIDAIHIIKSSEMVQGPYFPQLEDLVELSSPRCR*( +) MDSIYASPPDFQRMKQRDKIRGLHLLEHFVNQCHQLEIKCEAWIKQGDPKEVICSEVKRVQPDL LVVGSRGLGPFQRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |