Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0478100_circ_g.1 |
| ID in PlantcircBase | osa_circ_007135 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 17909855-17910123 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0478100 |
| Parent gene annotation |
Heat shock protein DnaJ, N-terminal domain containing protein. ( Os10t0478100-01);Heat shock protein DnaJ, N-terminal domain cont aining protein. (Os10t0478100-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0478100-02:2 Os10t0478100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117099628 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17910083-17909857(-) 17909882-17910086(-) |
| Potential amino acid sequence |
MAYKRRRKDAESNKDAEHLFKLERAYDMVMMEQLQNRKNGVAYGSIQILGISPLDGFDQVKMAY KRRRKDAESNKDAEHLFKLERAYDMVMMEQLQNRKNGVAYGSIQILGISPLDGFDQVKMAYKRR RKDAESNKDAEHLFKLERAYDMVMMEQLQNRKNGVAYGSIQILGISPLDGFDQVKMAYKRRRKD AESNKDAEHLFKLERAYDMVMMEQLQNRKNGVAYGSIQ(-) MGWHMDQSRFWGSVHLMGSTR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |